| Desktop | 97/100 | ✔ |
| Mobile | 74/100 | ❗ |
| Field | Data | Result |
|---|---|---|
| Page Size | 42 KB | ✔ |
| Compression | 14 KB (-66.5%) | ✔ |
| Text/Html Ratio | 932 / 43331 (bytes) = 2.15% | ❗ |
| Load Time | 0.36 second | ✔ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 18 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | English | ✔ |
| Preferred Domain | No | ❗ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | Yes | ✘ | Images Without ALT | 0 / 3 | ✔ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | No | ✘ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| october | 8 | ✘ | ✘ | ✘ |
| mark | 4 | ✔ | ✔ | ✘ |
| patient | 4 | ✘ | ✘ | ✘ |
| times | 4 | ✘ | ✘ | ✘ |
| medical | 2 | ✘ | ✘ | ✘ |
| inquicker | 2 | ✘ | ✘ | ✘ |
| established | 2 | ✘ | ✘ | ✘ |
| family | 2 | ✘ | ✘ | ✘ |
| appointment | 2 | ✘ | ✔ | ✘ |
| jump | 1 | ✘ | ✘ | ✘ |
| next | 1 | ✘ | ✘ | ✘ |
| logo | 1 | ✘ | ✘ | ✘ |
| areregistered | 1 | ✘ | ✘ | ✘ |
| servicemarks | 1 | ✘ | ✘ | ✘ |
| terms | 1 | ✘ | ✘ | ✘ |
|
With 0.36 seconds in page load, 42 KB of page size and all other reports below, the grandviewprimarycarepelham.com has a SEO score of 60 out of 100 |
| Title | Mark Whitworth, MD |
| Description | Book an Appointment online with Mark Whitworth, MD today. Enjoy the control and convenience of online scheduling today. |
| Keyword |
| Age | 0 Years, 5 Days |
| Created | 6th-Oct-2022 |
| Updated | 6th-Oct-2022 |
| Expiry | 6th-Oct-2023 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| grandviewprimarycarepelham.com | A | 595 | ip:3.33.152.147 |
| grandviewprimarycarepelham.com | A | 595 | ip:15.197.142.173 |
| grandviewprimarycarepelham.com | NS | 3600 | target:ns30.domaincontrol.com |
| grandviewprimarycarepelham.com | NS | 3600 | target:ns29.domaincontrol.com |
| grandviewprimarycarepelham.com | SOA | 3600 | mname:ns29.domaincontrol.comrname:dns.jomax.netserial:2022100602refresh:28800retry:7200expire:604800minimum-ttl:600 |
|
Domain Name: grandviewprimarycarepelham.com Registry Domain ID: 2730389073_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: https://www.godaddy.com Updated Date: 2022-10-06T17:38:22Z Creation Date: 2022-10-06T17:38:21Z Registrar Registration Expiration Date: 2023-10-06T17:38:21Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Registry Registrant ID: Not Available From Registry Registrant Name: Registration Private Registrant Organization: Domains By Proxy, LLC Registrant Street: DomainsByProxy.com Registrant Street: 2155 E Warner Rd Registrant City: Tempe Registrant State/Province: Arizona Registrant Postal Code: 85284 Registrant Country: US Registrant Phone: +1.4806242599 Registrant Phone Ext: Registrant Fax: +1.4806242598 Registrant Fax Ext: Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=grandviewprimarycarepelham.com Registry Admin ID: Not Available From Registry Admin Name: Registration Private Admin Organization: Domains By Proxy, LLC Admin Street: DomainsByProxy.com Admin Street: 2155 E Warner Rd Admin City: Tempe Admin State/Province: Arizona Admin Postal Code: 85284 Admin Country: US Admin Phone: +1.4806242599 Admin Phone Ext: Admin Fax: +1.4806242598 Admin Fax Ext: Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=grandviewprimarycarepelham.com Registry Tech ID: Not Available From Registry Tech Name: Registration Private Tech Organization: Domains By Proxy, LLC Tech Street: DomainsByProxy.com Tech Street: 2155 E Warner Rd Tech City: Tempe Tech State/Province: Arizona Tech Postal Code: 85284 Tech Country: US Tech Phone: +1.4806242599 Tech Phone Ext: Tech Fax: +1.4806242598 Tech Fax Ext: Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=grandviewprimarycarepelham.com Name Server: NS29.DOMAINCONTROL.COM Name Server: NS30.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2022-10-11T00:53:16Z |
| Server IP | 3.33.152.147 |
| Server Location | United States of America |
| Service Provider | AMAZON-02 |
| Domains (TLD) | Status |
|---|---|
| grandviewprimarycarepelham.net | Available |
| grandviewprimarycarepelham.org | Already Registered |
| grandviewprimarycarepelham.biz | Available |
| grandviewprimarycarepelham.io | Already Registered |
| grandviewprimarycarepelham.info | Already Registered |
| Domains (TLD) | Status |
|---|---|
| rrandviewprimarycarepelham.com | Available |
| frandviewprimarycarepelham.com | Available |
| vrandviewprimarycarepelham.com | Available |
| trandviewprimarycarepelham.com | Available |
| brandviewprimarycarepelham.com | Available |
| Vrkwholesale.com |
| Cheshirecatcoaching.com |
| Anhnhuongsuachuadogo.com |
| Loginpost5.us |
| Futurelogisticsolutions.com |
| Isauditr.com |
| Cryptoauditprotection.com |
| Surgetrend.com |
| Mytattons.com |
| Leachuang.com |